Recombinant Human TFEB protein, T7/His-tagged
Cat.No. : | TFEB-212H |
Product Overview : | Recombinant human TFEB (475aa, Isoform-1. derived from BC032448) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 475 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGFASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGP PTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASP GVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDP QVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWN KGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQ ELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPGHGS PFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | TFEB transcription factor EB [ Homo sapiens ] |
Official Symbol | TFEB |
Synonyms | TFEB; transcription factor EB; bHLHe35; TCFEB; T-cell transcription factor EB; BHLHE35; ALPHATFEB; |
Gene ID | 7942 |
mRNA Refseq | NM_001167827 |
Protein Refseq | NP_001161299 |
MIM | 600744 |
UniProt ID | P19484 |
Chromosome Location | 6p21 |
Function | DNA binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
TFEB-635H | Recombinant Human TFEB Protein, His-tagged | +Inquiry |
TFEB-14HFL | Recombinant Full Length Human transcription factor EB Protein, N-GST tagged | +Inquiry |
TFEB-8212Z | Recombinant Zebrafish TFEB | +Inquiry |
TFEB-12H | Recombinant Full Length Human transcription factor EB Protein, T7&His&TEV tagged | +Inquiry |
TFEB-4496R | Recombinant Rhesus Macaque TFEB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFEB-1128HCL | Recombinant Human TFEB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFEB Products
Required fields are marked with *
My Review for All TFEB Products
Required fields are marked with *
0
Inquiry Basket