Recombinant Human TEX43 Protein, GST-tagged

Cat.No. : TEX43-4299H
Product Overview : Human FLJ27505 full-length ORF ( NP_997291.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TEX43 (Testis Expressed 43) is a Protein Coding gene.
Molecular Mass : 41.9 kDa
AA Sequence : MASGKDTCPTLPKLTNNCSDESLYKSANKYEEIHLPRFSLKQGMIPRRYVMPWKENMIFRNVNLKQAEVCGIHTGPLEDSLFLNHSERLCHGEDRKVVFQKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TEX43 testis expressed 43 [ Homo sapiens (human) ]
Official Symbol TEX43
Synonyms Testis Expressed 43; Testis Specific Expressed Gene 7; C5orf48; Testis-Expressed Sequence 43 Protein; Chromosome 5 Open Reading Frame 48; Testis-Expressed Protein 43; Tseg7; TEX43; testis expressed 43
Gene ID 389320
mRNA Refseq NM_207408
Protein Refseq NP_997291
UniProt ID Q6ZNM6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TEX43 Products

Required fields are marked with *

My Review for All TEX43 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon