Recombinant Full Length Human TEX43 Protein, GST-tagged

• Cat.No.: TEX43-4987HF
• Product Overview: Human FLJ27505 full-length ORF ( NP_997291.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 134 amino acids
• Description: TEX43 (Testis Expressed 43) is a Protein Coding gene.
• Molecular Mass: 41.9 kDa
• AA Sequence: MASGKDTCPTLPKLTNNCSDESLYKSANKYEEIHLPRFSLKQGMIPRRYVMPWKENMIFRNVNLKQAEVCGIHTGPLEDSLFLNHSERLCHGEDRKVVFQKGPPEIKIADMPLHSPLSRYQSTVISHGFRRRLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TEX43 testis expressed 43 [ Homo sapiens (human) ]
• Official Symbol: TEX43
• Synonyms: Testis Expressed 43; Testis Specific Expressed Gene 7; C5orf48; Testis-Expressed Sequence 43 Protein; Chromosome 5 Open Reading Frame 48; Testis-Expressed Protein 43; Tseg7; TEX43; testis expressed 43
• Gene ID: 389320
• mRNA Refseq: NM_207408
• Protein Refseq: NP_997291
• UniProt ID: Q6ZNM6