Recombinant Human TEX30 Protein, GST-tagged

Cat.No. : TEX30-525H
Product Overview : Human C13orf27 full-length ORF ( NP_620134.2, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 47.6 kDa
AA Sequence : MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TEX30 testis expressed 30 [ Homo sapiens (human) ]
Official Symbol TEX30
Synonyms C13orf27
Gene ID 93081
mRNA Refseq NM_138779.2
Protein Refseq NP_620134.2
UniProt ID Q5JUR7.1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TEX30 Products

Required fields are marked with *

My Review for All TEX30 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon