Recombinant Full Length Human TEX30 Protein, GST-tagged

• Cat.No.: TEX30-1776HF
• Product Overview: Human C13orf27 full-length ORF ( NP_620134.2, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 186 amino acids
• Description: Predicted to enable hydrolase activity.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47.6 kDa
• AA Sequence: MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TEX30 testis expressed 30 [ Homo sapiens (human) ]
• Official Symbol: TEX30
• Synonyms: C13orf27
• Gene ID: 93081
• mRNA Refseq: NM_138779.2
• Protein Refseq: NP_620134.2
• UniProt ID: Q5JUR7