Recombinant Human TEX19 Protein, GST-tagged

Cat.No. : TEX19-4317H
Product Overview : Human FLJ35767 full-length ORF ( NP_997342.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TEX19 (Testis Expressed 19) is a Protein Coding gene.
Molecular Mass : 44.9 kDa
AA Sequence : MCPPVSMRYEEEGMSYLYASWMYQLQHGDQLSICFTCFKAAFLDFKDLLESEDWEEDNWDPELMEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDAGLDPHFVPTELWPQEAVPLGLGLEDADWTQGLPWRFEELLTCSHWPSFFPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TEX19 testis expressed 19 [ Homo sapiens (human) ]
Official Symbol TEX19
Synonyms TEX19; testis expressed 19; testis-expressed protein 19; testis-expressed sequence 19 protein
Gene ID 400629
mRNA Refseq NM_207459
Protein Refseq NP_997342
UniProt ID Q8NA77

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TEX19 Products

Required fields are marked with *

My Review for All TEX19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon