Recombinant Human TET1 Protein, GST-tagged

• Cat.No.: TET1-2207H
• Product Overview: Human TET1 partial ORF ( NP_085128.1, 2038 a.a. - 2136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the DNA methylation process and gene activation. [provided by RefSeq, Sep 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: RNHPTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TET1 tet methylcytosine dioxygenase 1 [ Homo sapiens (human) ]
• Official Symbol: TET1
• Synonyms: TET1; LCX; CXXC6; bA119F7.1; tet methylcytosine dioxygenase 1; methylcytosine dioxygenase TET1; CXXC finger 6; tet oncogene 1; CXXC zinc finger 6; ten-eleven translocation-1; CXXC-type zinc finger protein 6; ten-eleven translocation 1 gene protein; leukemia-associated protein with a CXXC domain; EC 1.14.11.n2
• Gene ID: 80312
• mRNA Refseq: NM_030625
• Protein Refseq: NP_085128
• MIM: 607790
• UniProt ID: Q8NFU7