Recombinant Human TERT Protein, His-tagged

• Cat.No.: TERT-32H
• Product Overview: Recombinant partial human TERT protein (281-436aa) with a N-terminal 6xHis tag was expressed in E.coli.

Specification

• Description: Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.
• Source: E.coli
• Species: Human
• Tag: His
• Molecular Mass: 22.7kDa
• AA Sequence: EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Storage Buffer: Tris-based buffer,50% glycerol
• Protein length: 281-436 a.a.

Gene Information

• Gene Name: TERT telomerase reverse transcriptase [ Homo sapiens (human) ]
• Official Symbol: TERT
• Synonyms: TERT; telomerase reverse transcriptase; TP2; TRT; CMM9; EST2; TCS1; hTRT; DKCA2; DKCB4; hEST2; PFBMFT1; telomerase reverse transcriptase; telomerase catalytic subunit; telomerase-associated protein 2; EC 2.7.7.49
• Gene ID: 7015
• mRNA Refseq: NM_198253
• Protein Refseq: NP_937983
• MIM: 187270
• UniProt ID: O14746