Recombinant Human TEAD3 Protein, His-SUMO-tagged

• Cat.No.: TEAD3-1382H
• Product Overview: Recombinant Human TEAD3 Protein (112-435aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 112-435 a.a.
• Description: This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 52.3 kDa
• AA Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: TEAD3 TEA domain transcription factor 3 [ Homo sapiens (human) ]
• Official Symbol: TEAD3
• Synonyms: TEF5; TEAD5; TEF-5; DTEF-1; ETFR-1; TEAD-3
• Gene ID: 7005
• mRNA Refseq: NM_003214.3
• Protein Refseq: NP_003205.2
• MIM: 603170
• UniProt ID: Q99594