Recombinant Human TEAD3 protein, GST-tagged

• Cat.No.: TEAD3-28H
• Product Overview: Recombinant Human TEAD3(215 a.a. - 302 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 215 a.a. - 302 a.a.
• Description: This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorionic somatomammotropin-B gene enhancer. Translation of this protein is initiated at a non-AUG (AUA) start codon.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.42 kDa
• AA Sequence: WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: TEAD3 TEA domain family member 3 [ Homo sapiens ]
• Official Symbol: TEAD3
• Synonyms: TEAD3; TEA domain family member 3; TEAD5; transcriptional enhancer factor TEF-5; ETFR 1; TEF 5; TEA domain family member 5; transcriptional enhancer factor 5; transcriptional enhancer factor TEF-5 (DTEF-1); TEF5; TEF-5; DTEF-1; ETFR-1; TEAD-3
• Gene ID: 7005
• mRNA Refseq: NM_003214
• Protein Refseq: NP_003205
• MIM: 603170
• UniProt ID: Q99594
• Chromosome Location: 6p21.2
• Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; PPARA Activates Gene Expression, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding transcription factor activity