Recombinant Human TDO2 Protein (1-406 aa), His-tagged

• Cat.No.: TDO2-1535H
• Product Overview: Recombinant Human TDO2 Protein (1-406 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-406 aa
• Description: Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 49.9 kDa
• AA Sequence: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TDO2 tryptophan 2,3-dioxygenase [ Homo sapiens ]
• Official Symbol: TDO2
• Synonyms: TDO2; TDO; TPH2; tryptophanase; TO; TRPO
• Gene ID: 6999
• mRNA Refseq: NM_005651
• Protein Refseq: NP_005642
• MIM: 191070
• UniProt ID: P48775