Recombinant Human TCP11

Cat.No. : TCP11-27007TH
Product Overview : Recombinant fragment of Human TCP11, isoform 2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : T-complex protein 11 homolog is a protein that in humans is encoded by the TCP11 gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed only in fertile adult testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
Sequence Similarities : Belongs to the TCP11 family.
Gene Name TCP11 t-complex 11 homolog (mouse) [ Homo sapiens ]
Official Symbol TCP11
Synonyms TCP11; t-complex 11 homolog (mouse); D6S230E, t complex 11 (a murine tcp homolog); T-complex protein 11 homolog; KIAA0229;
Gene ID 6954
mRNA Refseq NM_001093728
Protein Refseq NP_001087197
MIM 186982
Uniprot ID Q8WWU5
Chromosome Location 6p21.31

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCP11 Products

Required fields are marked with *

My Review for All TCP11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon