Recombinant Full Length Rat T-Complex Protein 11 Homolog(Tcp11) Protein, His-Tagged
Cat.No. : | RFL33070RF |
Product Overview : | Recombinant Full Length Rat T-complex protein 11 homolog(Tcp11) Protein (Q5XI00) (1-566aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-566) |
Form : | Lyophilized powder |
AA Sequence : | MPDLKERAARKEPGAAESASRESRGGNTRESASSAQGHRSRRFNRRSSTAALTPGSAQGR GVQTAPRAPVGHGGLRTGLTSRCPQPSARAKLPSVTRGAPLPPSPGKGHFGATPISHRLG LTERVHDASKLDCHLEDRKSASSLESRGKEVMPSDFWDHLKEQLSAVPPDFSCALELLKE IKEILLSLLLPRQSRLRNEIEEALDMEFLHQQADRGDLNVSYLSKYILNMMVLLCAPVRD EAVQRLENISDPVRLLRGIFQVLGQMKMDMVNYTIQSLQPQLQEHSIQFERAQFQERLNK DPSLLNHTTKWLTQAATQLIAPSGSCYDIQDPSSSSGPSPSDIAIPEPLSPAMVLSQGFL NLLTWDPENEEFPETLLADRSRLQELESQQNQLTILASVLLVASSFSGSVLFGSPQFVDR LKRITKSLVEDFNSRPEEVMQTVSDQVTEEIHQSLKNMGLSPLSSENTDSLIGQLQNIAK KENCVRSVIDQRIHLFLKCCFVLGVQRSLLDLPGGLSLIEAELAELGQKFVSLTHHNQQV FAPYYTEILKTLINPVQTLTTKVGSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tcp11 |
Synonyms | Tcp11; T-complex protein 11 homolog |
UniProt ID | Q5XI00 |
◆ Recombinant Proteins | ||
TDRD3-6000R | Recombinant Rat TDRD3 Protein | +Inquiry |
POU3F2-1739H | Recombinant Human POU3F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENO2-3313H | Recombinant Human ENO2 Protein, GST-tagged | +Inquiry |
VWA1-1100H | Recombinant Human VWA1 | +Inquiry |
SSTR3-2187C | Recombinant Chicken SSTR3 | +Inquiry |
◆ Native Proteins | ||
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
APOE-5336H | Native Human Apolipoprotein E | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
Lectin-1718P | Native Peanut Lectin, PE conjugated | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCF7ADRr-002WCY | Human Breast Adenocarcinoma MCF7ADRr Whole Cell Lysate | +Inquiry |
C7orf42-7966HCL | Recombinant Human C7orf42 293 Cell Lysate | +Inquiry |
MCOLN3-4413HCL | Recombinant Human MCOLN3 293 Cell Lysate | +Inquiry |
EIF3E-6662HCL | Recombinant Human EIF3E 293 Cell Lysate | +Inquiry |
PIR-3169HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tcp11 Products
Required fields are marked with *
My Review for All Tcp11 Products
Required fields are marked with *
0
Inquiry Basket