Recombinant Human TCL1B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TCL1B-5661H
• Product Overview: TCL1B MS Standard C13 and N15-labeled recombinant protein (NP_004909) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TCL1B (TCL1 Family AKT Coactivator B) is a Protein Coding gene. Diseases associated with TCL1B include T-Cell Lymphoblastic Leukemia/Lymphoma and Leukemia. Among its related pathways are PI3K-Akt signaling pathway. An important paralog of this gene is MTCP1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.9 kDa
• AA Sequence: MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TCL1B T-cell leukemia/lymphoma 1B [ Homo sapiens (human) ]
• Official Symbol: TCL1B
• Synonyms: TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1
• Gene ID: 9623
• mRNA Refseq: NM_004918
• Protein Refseq: NP_004909
• MIM: 603769
• UniProt ID: O95988