Recombinant Human TCL1B Protein, His-tagged

• Cat.No.: TCL1B-320H
• Product Overview: Recombinant Human TCL1B Protein, His-tagged,expressed in E. coli.

Specification

• Description: TCL1B belongs to the TCL1 family and is expressed in a variety of tissues including placenta and testis. This protein enhances the phosphorylation and activation of AKT1 and AKT2. Recombinant human TCL1B protein, fused to His-tag, was expressed in E.coli and purified by using conventional chromatography techniques.
• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 2-128 aa
• Molecular Mass: 16 kDa
• AA Sequence: MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPRRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKDHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.77mg/ml by BCA
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose

Gene Information

• Gene Name: TCL1B TCL1 family AKT coactivator B [ Homo sapiens (human) ]
• Official Symbol: TCL1B
• Synonyms: TCL1B; T-cell leukemia/lymphoma 1B; T-cell leukemia/lymphoma protein 1B; TML1; oncogene TCL-1B; TCL1/ MTCP1-like 1; T-cell lymphoma/leukemia 1B; syncytiotrophoblast-specific protein; SYN-1
• Gene ID: 9623
• mRNA Refseq: NM_004918
• Protein Refseq: NP_004909
• MIM: 603769
• UniProt ID: O95988