Recombinant Human TCEB1

Cat.No. : TCEB1-30815TH
Product Overview : Recombinant full length Human TCEB1 with N terminal proprietary tag; Predicted MWt 38.06 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 112 amino acids
Description : This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Molecular Weight : 38.060kDa inclusive of tags
Tissue specificity : Overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSG TIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Sequence Similarities : Belongs to the SKP1 family.
Gene Name TCEB1 transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) [ Homo sapiens ]
Official Symbol TCEB1
Synonyms TCEB1; transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C); transcription elongation factor B (SIII), polypeptide 1 (15kD, elongin C); transcription elongation factor B polypeptide 1; SIII;
Gene ID 6921
mRNA Refseq NM_001204863
Protein Refseq NP_001191792
MIM 600788
Uniprot ID Q15369
Chromosome Location 8q13.3
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCEB1 Products

Required fields are marked with *

My Review for All TCEB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon