Recombinant Human TBL3 protein, GST-tagged

• Cat.No.: TBL3-6874H
• Product Overview: Recombinant Human TBL3 protein(591-720 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 591-720 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: TIKNNECVRTLDAHEDKVWGLHCSRLDDHALTGASDSRVILWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKRYLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLEATMLRLRRDQKEALLRFCVT
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: TBL3 transducin (beta)-like 3 [ Homo sapiens ]
• Official Symbol: TBL3
• Synonyms: TBL3; transducin (beta)-like 3; transducin beta-like protein 3; SAZD; UTP13; WD-repeat protein SAZD; WD repeat-containing protein SAZD
• mRNA Refseq: NM_006453
• Protein Refseq: NP_006444
• MIM: 605915
• UniProt ID: Q12788
• Gene ID: 10607