Recombinant Human TBL1 Protein, His-tagged

• Cat.No.: TBL1-118H
• Product Overview: Recombinant Human TBL1 Protein, fused to His-tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene.
• Form: Supplied as a 0.2 μm filtered solution in 20mM Tris, 0.15M NaCl (pH8.0)
• Molecular Mass: ~8.8 kDa
• AA Sequence: MSITSDEVNFLVYRYLQESGFSHSAATFGIESHISQSNINGTLVPPSALISILQKGLQYV EAEISINKDGT
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.8 mg/ml

Gene Information

• Gene Name: TBL1X transducin beta like 1 X-linked [ Homo sapiens (human) ]
• Official Symbol: TBL1X
• Synonyms: EBI; TBL1; CHNG8; SMAP55
• Gene ID: 6907
• mRNA Refseq: NM_001139466
• Protein Refseq: NP_001132938
• MIM: 300196
• UniProt ID: O60907