Recombinant Human TARDBP protein, GST-tagged

• Cat.No.: TARDBP-39H
• Product Overview: Recombinant Human TARDBP(1 - 260 aa) fused with GST tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: 1 - 260 aa
• Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). Normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
  Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks.
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).

Gene Information

• Gene Name: TARDBP TAR DNA binding protein [ Homo sapiens ]
• Official Symbol: TARDBP
• Synonyms: TARDBP; TAR DNA binding protein; TAR DNA-binding protein 43; ALS10; TDP 43; TAR DNA-binding protein-43; TDP-43
• Gene ID: 23435
• mRNA Refseq: NM_007375
• Protein Refseq: NP_031401
• MIM: 605078
• UniProt ID: Q13148
• Chromosome Location: 1p36.22
• Function: DNA binding; RNA binding; double-stranded DNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity