Recombinant Human TARDBP, GST-tagged

• Cat.No.: TARDBP-4735H
• Product Overview: Recombinant Human TARDBP(1 a.a. - 260 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
• Molecular Mass: 54.34 kDa
• AA Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVV NYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFV RFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKP FRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TARDBP TAR DNA binding protein [ Homo sapiens (human) ]
• Official Symbol: TARDBP
• Synonyms: TARDBP; TDP-43; TAR DNA binding protein; ASL 10; TAR DNA-binding protein 43; TDP43; TAR DNA-binding protein 43; OTTHUMP00000002173; TRA DNA-binding protein-43
• Gene ID: 23435
• mRNA Refseq: NM_007375
• Protein Refseq: NP_003140
• MIM: 605078
• UniProt ID: Q13148
• Chromosome Location: 1p36.22
• Function: RNA binding; double-stranded DNA binding; mRNA 3'-UTR binding; nucleotide binding; protein binding; sequence-specific DNA binding transcription factor activity