Recombinant Human TAF5L protein, GST-tagged
Cat.No. : | TAF5L-3549H |
Product Overview : | Recombinant Human TAF5L protein(O75529)(1-325aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-325aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 64 kDa |
AA Sequence : | MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TAF5L TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa [ Homo sapiens ] |
Official Symbol | TAF5L |
Synonyms | TAF5L; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa; TAF5 like RNA polymerase II, p300/CBP associated factor (PCAF) associated factor, 65 kD; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L; PAF65B; PCAF associated factor 65 beta; PAF65-beta; PCAF-associated factor 65 beta; |
Gene ID | 27097 |
mRNA Refseq | NM_001025247 |
Protein Refseq | NP_001020418 |
UniProt ID | O75529 |
◆ Recombinant Proteins | ||
TAF5L-3105H | Recombinant Human TAF5L, His-tagged | +Inquiry |
TAF5L-10225Z | Recombinant Zebrafish TAF5L | +Inquiry |
TAF5L-3549H | Recombinant Human TAF5L protein, GST-tagged | +Inquiry |
TAF5L-8969M | Recombinant Mouse TAF5L Protein, His (Fc)-Avi-tagged | +Inquiry |
TAF5L-16398M | Recombinant Mouse TAF5L Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF5L-1268HCL | Recombinant Human TAF5L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TAF5L Products
Required fields are marked with *
My Review for All TAF5L Products
Required fields are marked with *
0
Inquiry Basket