Recombinant Human TADA2B Protein, GST-tagged

• Cat.No.: TADA2B-4343H
• Product Overview: Human MGC21874 partial ORF ( XP_291105, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TADA2B functions as a transcriptional adaptor protein that potentiates transcription through coordination of histone acetyltransferase (HAT) activity and by linking activation factors to basal transcriptional machinery (Barlev et al., 2003 [PubMed 12972612]).[supplied by OMIM, Apr 2010]
• Molecular Mass: 37.73 kDa
• AA Sequence: AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TADA2B transcriptional adaptor 2B [ Homo sapiens ]
• Official Symbol: TADA2B
• Synonyms: TADA2B; transcriptional adaptor 2B; transcriptional adapter 2-beta; MGC21874; ADA2-beta; ADA2-like protein beta; transcriptional adaptor 2 (ADA2 homolog, yeast)-beta; ADA2B; ADA2(beta)
• Gene ID: 93624
• mRNA Refseq: NM_152293
• Protein Refseq: NP_689506
• MIM: 608790
• UniProt ID: Q86TJ2