Recombinant Human SYNGR1 Protein (1-191 aa), GST-tagged
Cat.No. : | SYNGR1-2126H |
Product Overview : | Recombinant Human SYNGR1 Protein (1-191 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Isoform 1B. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Involved in the regulation of short-term and long-term synaptic plasticity. |
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 48.0 kDa |
Protein length : | 1-191 aa |
AA Sequence : | MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SYNGR1 synaptogyrin 1 [ Homo sapiens ] |
Official Symbol | SYNGR1 |
Synonyms | SYNGR1; |
Gene ID | 9145 |
mRNA Refseq | NM_145738.2 |
Protein Refseq | NP_663791.1 |
MIM | 603925 |
UniProt ID | O43759 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SYNGR1 Products
Required fields are marked with *
My Review for All SYNGR1 Products
Required fields are marked with *
0
Inquiry Basket