Recombinant Human SUZ12
Cat.No. : | SUZ12-31487TH |
Product Overview : | Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Overexpressed in breast and colon cancer. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL |
Sequence Similarities : | Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger. |
Gene Name | SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | SUZ12 |
Synonyms | SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160; |
Gene ID | 23512 |
mRNA Refseq | NM_015355 |
Protein Refseq | NP_056170 |
MIM | 606245 |
Uniprot ID | Q15022 |
Chromosome Location | 17q21 |
Function | chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding; |
◆ Recombinant Proteins | ||
Suz12-6234M | Recombinant Mouse Suz12 Protein, Myc/DDK-tagged | +Inquiry |
SUZ12-2141H | Recombinant Human SUZ12 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUZ12-35H | Recombinant Human SUZ12 Protein, Myc/DDK-tagged | +Inquiry |
SUZ12-2744H | Recombinant Human SUZ12 Protein, His-tagged | +Inquiry |
SUZ12-763HFL | Recombinant Full Length Human SUZ12 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUZ12-1330HCL | Recombinant Human SUZ12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUZ12 Products
Required fields are marked with *
My Review for All SUZ12 Products
Required fields are marked with *
0
Inquiry Basket