Recombinant Human SUV39H2 protein, GST-tagged

• Cat.No.: SUV39H2-7854H
• Product Overview: Recombinant Human SUV39H2 protein(290-350 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 290-350 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: RLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SUV39H2
• Synonyms: SUV39H2; suppressor of variegation 3-9 homolog 2 (Drosophila); histone-lysine N-methyltransferase SUV39H2; FLJ23414; KMT1B; H3-K9-HMTase 2; su(var)3-9 homolog 2; lysine N-methyltransferase 1B; histone H3-K9 methyltransferase 2
• Gene ID: 79723
• mRNA Refseq: NM_001193424
• Protein Refseq: NP_001180353
• MIM: 606503
• UniProt ID: Q9H5I1