Recombinant Human SUMF2 protein, GST-tagged

• Cat.No.: SUMF2-3054H
• Product Overview: Recombinant Human SUMF2 fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFV SDELRNKATQPMKSVLWWLPVEKAF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SUMF2 sulfatase modifying factor 2 [ Homo sapiens ]
• Official Symbol: SUMF2
• Synonyms: SUMF2; sulfatase modifying factor 2; sulfatase-modifying factor 2; DKFZp566I1024; C-alpha-formyglycine-generating enzyme 2; C-alpha-formylglycine-generating enzyme 2; paralog of the formylglycine-generating enzyme; pFGE; MGC99485; DKFZp686I1024; DKFZp781L1035; DKFZp686L17160
• Gene ID: 25870
• mRNA Refseq: NM_015411
• Protein Refseq: NP_056226
• MIM: 607940
• UniProt ID: Q8NBJ7
• Chromosome Location: 7q11.1
• Function: binding; metal ion binding