Recombinant Human SULT1A3 protein, His-SUMO-tagged
Cat.No. : | SULT1A3-3544H |
Product Overview : | Recombinant Human SULT1A3 protein(P0DMM9)(1-295aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.2 kDa |
Protein length : | 1-295aa |
AA Sequence : | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SULT1A3 sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3 [ Homo sapiens ] |
Official Symbol | SULT1A3 |
Synonyms | SULT1A3; sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3; STM; sulfotransferase 1A3/1A4; TL PST; sulfokinase; phenol sulfotransferase 1A5; aryl sulfotransferase 1A3/1A4; dopamine-specific sulfotransferase; placental estrogen sulfotransferase; monoamine-sulfating phenosulfotransferase; catecholamine-sulfating phenol sulfotransferase; thermolabile (monoamine, M form) phenol sulfotransferase; HAST; HAST3; M-PST; ST1A5; TL-PST; ST1A3/ST1A4; MGC117469; |
Gene ID | 6818 |
mRNA Refseq | NM_177552 |
Protein Refseq | NP_808220 |
MIM | 600641 |
UniProt ID | P50224 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SULT1A3 Products
Required fields are marked with *
My Review for All SULT1A3 Products
Required fields are marked with *
0
Inquiry Basket