Recombinant Human SUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SUB1-3417H
• Product Overview: SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.4 kDa
• AA Sequence: MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ]
• Official Symbol: SUB1
• Synonyms: SUB1; SUB1 homolog (S. cerevisiae); activated RNA polymerase II transcriptional coactivator p15; p14; p15; PC4; positive cofactor 4; activated RNA polymerase II transcription cofactor 4; P15; MGC102747
• Gene ID: 10923
• mRNA Refseq: NM_006713
• Protein Refseq: NP_006704
• MIM: 600503
• UniProt ID: P53999