Recombinant Human SUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SUB1-3417H
Product Overview : SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 14.4 kDa
AA Sequence : MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ]
Official Symbol SUB1
Synonyms SUB1; SUB1 homolog (S. cerevisiae); activated RNA polymerase II transcriptional coactivator p15; p14; p15; PC4; positive cofactor 4; activated RNA polymerase II transcription cofactor 4; P15; MGC102747;
Gene ID 10923
mRNA Refseq NM_006713
Protein Refseq NP_006704
MIM 600503
UniProt ID P53999

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SUB1 Products

Required fields are marked with *

My Review for All SUB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon