Recombinant Human STX2
Cat.No. : | STX2-30658TH |
Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 287 amino acids |
Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 57.640kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS |
Sequence Similarities : | Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain. |
Gene Name | STX2 syntaxin 2 [ Homo sapiens ] |
Official Symbol | STX2 |
Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; |
Gene ID | 2054 |
mRNA Refseq | NM_001980 |
Protein Refseq | NP_001971 |
MIM | 132350 |
Uniprot ID | P32856 |
Chromosome Location | 12q24 |
Pathway | Botulinum neurotoxicity, organism-specific biosystem; Neuronal System, organism-specific biosystem; Proteolytic cleavage of SNARE complex proteins, organism-specific biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
Function | SNAP receptor activity; SNARE binding; calcium-dependent protein binding; protein binding; |
◆ Recombinant Proteins | ||
RFL15805HF | Recombinant Full Length Human Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry |
RFL20799RF | Recombinant Full Length Rat Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry |
STX2-6854H | Recombinant Human Syntaxin 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *
0
Inquiry Basket