Recombinant Full Length Rat Syntaxin-2(Stx2) Protein, His-Tagged
Cat.No. : | RFL20799RF |
Product Overview : | Recombinant Full Length Rat Syntaxin-2(Stx2) Protein (P50279) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Stx2 |
Synonyms | Stx2; Epim; Syntaxin-2; Epimorphin |
UniProt ID | P50279 |
◆ Recombinant Proteins | ||
STX2-6854H | Recombinant Human Syntaxin 2, His-tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
Stx2-411M | Active Recombinant Mouse Syntaxin 2 | +Inquiry |
RFL20799RF | Recombinant Full Length Rat Syntaxin-2(Stx2) Protein, His-Tagged | +Inquiry |
STX2-3547C | Recombinant Chicken STX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Stx2 Products
Required fields are marked with *
My Review for All Stx2 Products
Required fields are marked with *
0
Inquiry Basket