Recombinant Human STMN1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : STMN1-4822H
Product Overview : STMN1 MS Standard C13 and N15-labeled recombinant protein (NP_981944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 17.3 kDa
AA Sequence : MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEADTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name STMN1 stathmin 1 [ Homo sapiens (human) ]
Official Symbol STMN1
Synonyms STMN1; stathmin 1; C1orf215, chromosome 1 open reading frame 215, LAP18, stathmin 1/oncoprotein 18; stathmin; FLJ32206; Lag; oncoprotein 18; OP18; PP17; PP19; PR22; SMN; prosolin; metablastin; phosphoprotein 19; phosphoprotein p19; stathmin 1/oncoprotein 18; transmembrane protein C1orf215; leukemia-associated phosphoprotein p18; LAP18; C1orf215; MGC138869; MGC138870;
Gene ID 3925
mRNA Refseq NM_203399
Protein Refseq NP_981944
MIM 151442
UniProt ID P16949

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All STMN1 Products

Required fields are marked with *

My Review for All STMN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon