Recombinant Human STMN1, GST-tagged

• Cat.No.: STMN1-364H
• Product Overview: Recombinant Human STMN1(1 a.a. - 149 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 43.7 kDa
• AA Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEK REHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: STMN1 stathmin 1 [ Homo sapiens ]
• Official Symbol: STMN1
• Synonyms: STMN1; LAP18; Lag; OP18; PP17; PP19; PR22; SMN; stathmin 1; Lag; SMN; LAP18; C1orf215; FLJ32206; MGC138869; MGC138870; prosolin; metablastin; oncoprotein 18; phosphoprotein 19; OTTHUMP00000008527; OTTHUMP00000008528; OTTHUMP00000008530; stathmin 1/oncoprotein 18; leukemia-associated phosphoprotein p18; Metablastin; pp17; pp19; Protein Pr22; chromosome 1 open reading frame 215
• Gene ID: 3925
• mRNA Refseq: NM_005563
• Protein Refseq: NP_005554
• MIM: 151442
• UniProt ID: P16949
• Chromosome Location: 19p13.3
• Pathway: Aurora B signaling; MAPK signaling pathway; MicroRNAs in cancer
• Function: signal transducer activity; tubulin binding