Recombinant Human STMN1 protein, GST-tagged

• Cat.No.: STMN1-361H
• Product Overview: Recombinant Human STMN1 protein(NP_001138926)(1-149 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-149 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: STMN1 stathmin 1 [ Homo sapiens ]
• Official Symbol: STMN1
• Synonyms: STMN1; stathmin 1; C1orf215, chromosome 1 open reading frame 215 , LAP18, stathmin 1/oncoprotein 18; stathmin; FLJ32206; Lag; oncoprotein 18; OP18; PP17; PP19; PR22; SMN; prosolin; metablastin; phosphoprotein 19; phosphoprotein p19; stathmin 1/oncoprotein 18; transmembrane protein C1orf215; leukemia-associated phosphoprotein p18; LAP18; C1orf215; MGC138869; MGC138870
• Gene ID: 3925
• mRNA Refseq: NM_001145454
• Protein Refseq: NP_001138926
• MIM: 151442
• UniProt ID: P16949