Recombinant Human STK38L protein(212-464aa), GST-tagged

• Cat.No.: STK38L-593H
• Product Overview: Recombinant Human STK38L protein(Q9Y2H1)(212-464aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Protein length: 212-464aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.1 kDa
• AASequence: RDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: STK38L serine/threonine kinase 38 like [ Homo sapiens ]
• Official Symbol: STK38L
• Synonyms: STK38L; serine/threonine kinase 38 like; serine/threonine-protein kinase 38-like; KIAA0965; NDR2; nuclear Dbf2 related 2; NDR2 protein kinase; nuclear Dbf2-related 2; nuclear Dbf2-related kinase 2
• Gene ID: 23012
• mRNA Refseq: NM_015000
• Protein Refseq: NP_055815
• UniProt ID: Q9Y2H1