Recombinant Human STIP1 protein(191-290 aa), C-His-tagged
Cat.No. : | STIP1-2723H |
Product Overview : | Recombinant Human STIP1 protein(P31948)(191-290 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-290 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGR |
Gene Name | STIP1 stress-induced-phosphoprotein 1 [ Homo sapiens ] |
Official Symbol | STIP1 |
Synonyms | STIP1; stress-induced-phosphoprotein 1; HOP; Hsp70/Hsp90 organizing protein; STI1; NY-REN-11 antigen; Hsp70/Hsp90-organizing protein; hsc70/Hsp90-organizing protein; renal carcinoma antigen NY-REN-11; transformation-sensitive protein IEF SSP 3521; P60; STI1L; IEF-SSP-3521; |
Gene ID | 10963 |
mRNA Refseq | NM_006819 |
Protein Refseq | NP_006810 |
MIM | 605063 |
UniProt ID | P31948 |
◆ Recombinant Proteins | ||
STIP1-3536H | Recombinant Human STIP1 protein, His-SUMO-tagged | +Inquiry |
STIP1-5789R | Recombinant Rat STIP1 Protein | +Inquiry |
STIP1-8800M | Recombinant Mouse STIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stip1-127M | Recombinant Mouse Stip1 protein, His-tagged | +Inquiry |
STIP1-101H | Recombinant Human STIP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STIP1-641HCL | Recombinant Human STIP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STIP1 Products
Required fields are marked with *
My Review for All STIP1 Products
Required fields are marked with *
0
Inquiry Basket