Recombinant Human STAMBPL1 protein, GST-tagged

• Cat.No.: STAMBPL1-301261H
• Product Overview: Recombinant Human STAMBPL1 (116-289 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Pro116-Arg289
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: PRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: STAMBPL1 STAM binding protein-like 1 [ Homo sapiens ]
• Official Symbol: STAMBPL1
• Synonyms: STAMBPL1; STAM binding protein-like 1; AMSH-like protease; ALMalpha; AMSH FP; AMSH LP; associated molecule with the SH3 domain of STAM (AMSH) Family Protein; associated molecule with the SH3 domain of STAM (AMSH) like protein; bA399O19.2; FLJ31524; KIAA1373; associated molecule with the SH3 domain of STAM (AMSH) - Family Protein; AMSH-FP; AMSH-LP
• Gene ID: 57559
• mRNA Refseq: NM_020799
• Protein Refseq: NP_065850
• MIM: 612352
• UniProt ID: Q96FJ0