Recombinant Human ST8SIA2 Protein (AA 60-375), N-6×His/GFP tagged

• Cat.No.: ST8SIA2-20H
• Product Overview: Recombinant Human ST8SIA2 Protein (AA 60-375) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&GFP
• ProteinLength: AA 60-375
• Description: The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.
• Molecular Mass: ~100 kDa
• AA Sequence: NGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASAHTMPLEFKALKSLHEQGALKLTVGQCDGAT
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: ST8SIA2 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: ST8SIA2
• Synonyms: ST8SIA2; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2; sialyltransferase 8 (alpha 2, 8 sialytransferase) B , SIAT8B; alpha-2,8-sialyltransferase 8B; HsT19690; ST8SIA II; STX; SIAT8-B; ST8SiaII; sialyltransferase X; sialyltransferase 8B; sialytransferase St8Sia II; alpha-2,8-sialyltransferase 8B 1; sialyltransferase 8 (alpha-2, 8-sialytransferase) B; SIAT8B; ST8SIA-II; MGC116854; MGC116857
• Gene ID: 8128
• mRNA Refseq: NM_006011
• Protein Refseq: NP_006002
• MIM: 602546
• UniProt ID: Q92186