Recombinant Human SSX2 protein, GST-tagged
Cat.No. : | SSX2-301603H |
Product Overview : | Recombinant Human SSX2 (177-223 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn177-Trp223 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRENSW |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ] |
Official Symbol | SSX2 |
Synonyms | SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40; |
Gene ID | 6757 |
mRNA Refseq | NM_003147 |
Protein Refseq | NP_003138 |
MIM | 300192 |
UniProt ID | Q16385 |
◆ Recombinant Proteins | ||
SSX2-236H | Recombinant Human SSX2 protein, His/SUMO-tagged | +Inquiry |
SSX2-234H | Recombinant Human SSX2, His-tagged | +Inquiry |
SSX2-301603H | Recombinant Human SSX2 protein, GST-tagged | +Inquiry |
SSX2-737H | Recombinant Human SSX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSX2-2109H | Recombinant Human SSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX2-1449HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
SSX2-1448HCL | Recombinant Human SSX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSX2 Products
Required fields are marked with *
My Review for All SSX2 Products
Required fields are marked with *
0
Inquiry Basket