Recombinant Human SSX2 protein, GST-tagged

• Cat.No.: SSX2-301603H
• Product Overview: Recombinant Human SSX2 (177-223 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn177-Trp223
• AA Sequence: NTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRENSW
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ]
• Official Symbol: SSX2
• Synonyms: SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40
• Gene ID: 6757
• mRNA Refseq: NM_003147
• Protein Refseq: NP_003138
• MIM: 300192
• UniProt ID: Q16385