Recombinant Human SSX2 protein, His/SUMO-tagged

Description :	The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
Source :	E. coli
Species :	Human
Tag :	His&SUMO
Molecular Mass :	37.55kD
Protein length :	1-188aa
AA Sequence :	MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKR AEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEK IHERSGPKRGEHAWTHRLPERKQLVIYEEISDPEEDDE

Gene Name	SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ]
Official Symbol	SSX2
Synonyms	SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpoint 2B; CT5.2; tumor antigen HOM-MEL-40; cancer/testis antigen 5.2; synovial sarcoma, X breakpoint 2B; cancer/testis antigen family 5, member 2a; sarcoma, synovial, X-chromosome-related 2; synovial sarcoma, X breakpoint 2, isoform b; SSX2B; HOM-MEL-40;
Gene ID	6757
mRNA Refseq	NM_003147
Protein Refseq	NP_003138
MIM	300192
UniProt ID	Q16385
Chromosome Location	Xp11.22
Pathway	Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;

RRM2-705H	Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged	+Inquiry
FIS1-2477H	Recombinant Human FIS1, His-tagged	+Inquiry
RAB27A-2479H	Recombinant Human RAB27A, His-tagged	+Inquiry
RAB11A-2480H	Recombinant Human RAB11A, Member RAS Oncogene Family, His-tagged	+Inquiry
ADK-2481H	Recombinant Human Adenosine Kinase, His-tagged	+Inquiry