Recombinant Human SSX1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | SSX1-021H |
Product Overview : | SSX1 MS Standard C13 and N15-labeled recombinant protein (NP_005626) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX2 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome X. |
Molecular Mass : | 21.9 kDa |
AA Sequence : | MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SSX1 SSX family member 1 [ Homo sapiens (human) ] |
Official Symbol | SSX1 |
Synonyms | SSX1; SSX family member 1; CT5.1; SSRC; protein SSX1; cancer/testis antigen 5.1; cancer/testis antigen family 5, member 1; sarcoma, synovial, X-chromosome-related 1; synovial sarcoma, X breakpoint 1 |
Gene ID | 6756 |
mRNA Refseq | NM_005635 |
Protein Refseq | NP_005626 |
MIM | 312820 |
UniProt ID | Q16384 |
◆ Recombinant Proteins | ||
SSX1-31171TH | Recombinant Human SSX1 | +Inquiry |
SSX1-2040HFL | Recombinant Full Length Human SSX1 Protein, C-Flag-tagged | +Inquiry |
SSX1-499HF | Recombinant Full Length Human SSX1 Protein | +Inquiry |
SSX1-7541H | Recombinant Human SSX1, His-tagged | +Inquiry |
SSX1-30141TH | Recombinant Human SSX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSX1-1450HCL | Recombinant Human SSX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSX1 Products
Required fields are marked with *
My Review for All SSX1 Products
Required fields are marked with *
0
Inquiry Basket