Creative BioMart to Present at BPS 2025 Annual Meeting | February 15-19, 2025

Recombinant Full Length Human SSX1 Protein

Cat.No. : SSX1-499HF
Product Overview : Recombinant full length Human SSX1 with N terminal proprietary tag; predicted MWt 46.5 kDa inclusive of tag; Q16384,
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 46.750kDa inclusive of tags
Protein length : 188 amino acids
AA Sequence : MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKM KYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQ GNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRG KHAWTHRLRERKQLVIYEEISDPEEDDE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : SSX1 synovial sarcoma, X breakpoint 1 [ Homo sapiens ]
Official Symbol : SSX1
Synonyms : SSX1; synovial sarcoma, X breakpoint 1; protein SSX1; cancer/testis antigen family 5; member 1; CT5.1
Gene ID : 6756
mRNA Refseq : NM_005635
Protein Refseq : NP_005626
MIM : 312820
UniProt ID : Q16384

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SSX1 Products

Required fields are marked with *

My Review for All SSX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2025 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends