Recombinant Human SSX1

Cat.No. : SSX1-30141TH
Product Overview : Recombinant full length Human SSX1 with N terminal proprietary tag; predicted MWt 46.5 kDa inclusive of tag; Q16384,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 188 amino acids
Description : The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity.
Molecular Weight : 46.750kDa inclusive of tags
Tissue specificity : Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKM KYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQ GNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRG KHAWTHRLRERKQLVIYEEISDPEEDDE
Sequence Similarities : Belongs to the SSX family.Contains 1 KRAB-related domain.
Gene Name SSX1 synovial sarcoma, X breakpoint 1 [ Homo sapiens ]
Official Symbol SSX1
Synonyms SSX1; synovial sarcoma, X breakpoint 1; protein SSX1; cancer/testis antigen family 5; member 1; CT5.1;
Gene ID 6756
mRNA Refseq NM_005635
Protein Refseq NP_005626
MIM 312820
Uniprot ID Q16384
Chromosome Location Xp11.23
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function nucleic acid binding; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SSX1 Products

Required fields are marked with *

My Review for All SSX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon