Recombinant Human SSBP1

• Cat.No.: SSBP1-29275TH
• Product Overview: Recombinant full length Human SSBP1 with proprietary tag; Predicted MWt 41.69 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 148 amino acids
• Description: SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al.
• Molecular Weight: 41.690kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
• Sequence Similarities: Contains 1 SSB domain.

Gene Information

• Gene Name: SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ]
• Official Symbol: SSBP1
• Synonyms: SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP
• Gene ID: 6742
• mRNA Refseq: NM_003143
• Protein Refseq: NP_003134
• MIM: 600439
• Uniprot ID: Q04837
• Chromosome Location: 7q34
• Pathway: DNA replication, organism-specific biosystem; DNA replication, conserved biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem; Mismatch repair, organism-specific biosystem
• Function: DNA binding; chromatin binding; single-stranded DNA binding