Recombinant Human SSBP1 protein, His-tagged

• Cat.No.: SSBP1-2966H
• Product Overview: Recombinant Human SSBP1 protein(1-148 aa), fused with N-terminal His Tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-148 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ]
• Official Symbol: SSBP1
• Synonyms: SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP; PWP1-interacting protein 17; mtSSB; Mt-SSB; SOSS-B1
• Gene ID: 6742
• mRNA Refseq: NM_001256510
• Protein Refseq: NP_001243439
• MIM: 600439
• UniProt ID: Q04837