Recombinant Human SRSF7 protein, His-tagged

• Cat.No.: SRSF7-22H
• Product Overview: Recombinant Human SRSF7 protein(Q16629)(1-238 aa), fused with His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
  The volume before lyophilization is 20μl/vial.
• Molecular Mass: Predicted band size: 33.3 kDa
• Protein length: 1-238 aa
• AA Sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
• Purity: ≥85%, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
• Storage: Store at -20°C, for extended storage, conserve at -20°C or -80°C.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: SRSF7 serine/arginine-rich splicing factor 7 [ Homo sapiens ]
• Official Symbol: SRSF7
• Synonyms: SRSF7; serine/arginine-rich splicing factor 7; SFRS7, splicing factor, arginine/serine rich 7 (35kD) , splicing factor, arginine/serine rich 7, 35kDa; 9G8; AAG3; HSSG1; RBM37; SR splicing factor 7; ZCCHC20; ZCRB2; splicing factor 9G8; aging-associated protein 3; splicing factor, arginine/serine-rich 7, 35kDa; SFRS7
• Gene ID: 6432
• mRNA Refseq: NM_001031684
• Protein Refseq: NP_001026854
• MIM: 600572
• UniProt ID: Q16629