Recombinant Human SRSF7 protein, GST-tagged

• Cat.No.: SRSF7-21H
• Product Overview: Recombinant Human SRSF7(1 - 238 aa) fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-238 a.a.
• Description: The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants encoding different isoforms have been found for this gene.
• Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• AA Sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGS RVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRS RGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPS GSPRRSASPERMD
• Purity: > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: SRSF7 serine/arginine-rich splicing factor 7 [ Homo sapiens ]
• Official Symbol: SRSF7
• Synonyms: SRSF7; serine/arginine-rich splicing factor 7; SFRS7, splicing factor, arginine/serine rich 7 (35kD) , splicing factor, arginine/serine rich 7, 35kDa; 9G8; AAG3; HSSG1; RBM37; SR splicing factor 7; ZCCHC20; ZCRB2; splicing factor 9G8; aging-associated protein 3; splicing factor, arginine/serine-rich 7, 35kDa; SFRS7
• Gene ID: 6432
• mRNA Refseq: NM_001031684
• Protein Refseq: NP_001026854
• MIM: 600572
• UniProt ID: Q16629
• Chromosome Location: 2p22.1
• Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Gene expression, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; RNA Polymerase II Transcription, organism-specific biosystem; RNA Polymerase II Transcription Termination, organism-specific biosystem;
• Function: RNA binding; metal ion binding; nucleotide binding; protein binding; zinc ion binding