Recombinant Human SRI Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SRI-1882H
• Product Overview: SRI MS Standard C13 and N15-labeled recombinant protein (NP_003121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 21.7 kDa
• AA Sequence: MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SRI sorcin [ Homo sapiens (human) ]
• Official Symbol: SRI
• Synonyms: SRI; sorcin; H_RG167B05.1; 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells; SCN; V19; CP22; CP-22; FLJ26259
• Gene ID: 6717
• mRNA Refseq: NM_003130
• Protein Refseq: NP_003121
• MIM: 182520
• UniProt ID: P30626