Recombinant Human SREBF2

Cat.No. : SREBF2-31395TH
Product Overview : Recombinant fragment corresponding to amino acids 801-900 of Human SREBP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitously expressed in adult and fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
Sequence Similarities : Belongs to the SREBP family.Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name SREBF2 sterol regulatory element binding transcription factor 2 [ Homo sapiens ]
Official Symbol SREBF2
Synonyms SREBF2; sterol regulatory element binding transcription factor 2; sterol regulatory element-binding protein 2; bHLHd2; SREBP2;
Gene ID 6721
mRNA Refseq NM_004599
Protein Refseq NP_004590
MIM 600481
Uniprot ID Q12772
Chromosome Location 22q13.2
Function NOT C-8 sterol isomerase activity; chromatin binding; protein C-terminus binding; protein binding; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SREBF2 Products

Required fields are marked with *

My Review for All SREBF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon