Recombinant Human SQSTM1 protein(241-320 aa), C-His-tagged

• Cat.No.: SQSTM1-2854H
• Product Overview: Recombinant Human SQSTM1 protein(Q13501)(241-320 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 241-320 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• AASequence: GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SQSTM1 sequestosome 1 [ Homo sapiens ]
• Official Symbol: SQSTM1
• Synonyms: SQSTM1; sequestosome 1; OSIL, oxidative stress induced like , Paget disease of bone 3 , PDB3; sequestosome-1; A170; p60; p62; p62B; EBIAP; EBI3-associated protein p60; oxidative stress induced like; ubiquitin-binding protein p62; EBI3-associated protein of 60 kDa; phosphotyrosine independent ligand for the Lck SH2 domain p62; phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; OSIL; PDB3; ZIP3
• Gene ID: 8878
• mRNA Refseq: NM_001142298
• Protein Refseq: NP_001135770
• MIM: 601530
• UniProt ID: Q13501