Recombinant Human SPTA1 protein, His-tagged

Cat.No. : SPTA1-4572H
Product Overview : Recombinant Human SPTA1 protein(P02549)(53-474aa), fused to N-terminal His tag, was expressed in Mammalian cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : His
Protein Length : 53-474aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 52.9 kDa
AA Sequence : YHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALATSRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SPTA1 spectrin, alpha, erythrocytic 1 (elliptocytosis 2) [ Homo sapiens ]
Official Symbol SPTA1
Synonyms SPTA1; spectrin, alpha, erythrocytic 1 (elliptocytosis 2); spectrin alpha chain, erythrocyte; EL2; alpha-I spectrin; erythroid alpha-spectrin; HPP; HS3; SPH3; SPTA;
Gene ID 6708
mRNA Refseq NM_003126
Protein Refseq NP_003117
MIM 182860
UniProt ID P02549

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SPTA1 Products

Required fields are marked with *

My Review for All SPTA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon